Blend Tesamorelin + Ipamorelin
$234.99
This material is supplied solely as a laboratory research article. Buyer is responsible for ensuring lawful purchase, handling, storage, and use. We do not provide administration or therapeutic guidance.
Tesamorelin + Ipamorelin - GHRH Analog and Ghrelin-Receptor Peptide Blend, Research Reference Material
FOR LABORATORY RESEARCH USE ONLY. Not a drug, supplement, cosmetic, or food. Not for human or veterinary use, ingestion, injection, or any in-vivo administration. Not evaluated by the FDA.

Analytical Identity
| Common name | Tesamorelin + Ipamorelin |
|---|---|
| Amino-acid sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (Tesamorelin) / Aib-His-D-2-Nal-D-Phe-Lys-NH2 (Ipamorelin) |
| Sequence (3-letter) | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Asn-His |
| Residues | 31 |
| Molecular formula | C221H366N72O67S (Tesamorelin) / C38H49N9O5 (Ipamorelin) |
|---|---|
| Molecular weight | ~5196 g/mol (Tesamorelin) / ~711.9 g/mol (Ipamorelin) |
| Appearance | White to off-white lyophilized powder |
| Physical form | Lyophilized powder |
| Purity | Not less than 98% by HPLC (see lot-specific Certificate of Analysis) |
|---|---|
| Source | Synthetic |
| Catalog / SKU | TESA-IPAM-BLEND |
Tesamorelin + Ipamorelin is supplied as a laboratory research reference material intended strictly for in-vitro and laboratory research use only. The blend pairs two synthetic peptides of distinct architecture in a single lyophilized presentation, allowing analytical laboratories and formulation chemists to characterize each component and the mixture as a whole under a single catalog identifier (SKU: TESA-IPAM-BLEND).
The Tesamorelin component is a 44-residue-derived GHRH analog sequence supplied here as the 29-residue C-terminally amidated fragment YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, with molecular formula C221H366N72O67S and a monoisotopic-consistent average molecular weight of approximately 5196 g/mol. Its 3-letter sequence, Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Asn-His (31 residues as tabulated with N-terminal modification), features a single methionine that analysts should note as a potential oxidation site during method development, alongside multiple basic residues (Arg, Lys, His) that dominate its charge state envelope in positive-mode ESI-MS.
The Ipamorelin component is a compact pentapeptide with molecular formula C38H49N9O5 and an average molecular weight of approximately 711.9 g/mol, sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2. The presence of alpha-aminoisobutyric acid (Aib), D-2-naphthylalanine, and D-phenylalanine gives it a non-standard amino-acid signature that is readily distinguishable from Tesamorelin by reverse-phase HPLC retention behavior, UV absorbance from the naphthyl chromophore, and mass spectrometric fragmentation patterns, making the Tesamorelin + Ipamorelin blend a convenient dual-analyte reference for orthogonal separation and detection method work.
Both peptides are of synthetic origin and are presented as a white to off-white lyophilized powder. Purity is specified as not less than 98% by HPLC, with identity, purity, counter-ion content, and residual solvent data documented on the lot-specific Certificate of Analysis, available on request. The pronounced difference in molecular weight (~5196 vs. ~711.9 g/mol) supports clean resolution by size-exclusion chromatography and unambiguous discrimination in LC-MS workflows, and reference laboratories routinely use such disparate mass pairs to challenge dynamic range, ion suppression, and peak-capacity parameters.
Published scientific literature has examined Tesamorelin + Ipamorelin in preclinical and analytical contexts, and PEPTIDE.Power provides this material solely as a characterized chemical reference. PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding Tesamorelin + Ipamorelin and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion.
Physical format
Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.
Certificate of Analysis
| Analyte | Tesamorelin + Ipamorelin |
|---|---|
| CAS Number | - |
| Appearance | White to off-white lyophilized powder |
| Identity | Confirmed by HPLC and mass spectrometry |
Lot-specific COA available — contact [email protected] with your lot number.
Storage & handling
Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.
Scientific references
The following are independent, peer-reviewed publications provided for reference. They describe third-party research and are not representations by POWER BIOTECH LLC regarding this product.
- Effects of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial — https://pubmed.ncbi.nlm.nih.gov/20554517/
- Tesamorelin, a growth hormone-releasing factor analogue, in HIV-infected patients with excess abdominal fat — https://pmc.ncbi.nlm.nih.gov/articles/PMC2895528/
- Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials — https://pubmed.ncbi.nlm.nih.gov/18981031/
- Pharmacokinetics, pharmacodynamics, and safety of ipamorelin, a novel ghrelin mimetic peptide, in healthy volunteers — https://pubmed.ncbi.nlm.nih.gov/15741251/
- Ipamorelin, the first selective growth hormone secretagogue — https://pubmed.ncbi.nlm.nih.gov/9849822/
- Growth hormone-releasing hormone in the treatment of HIV-associated lipodystrophy — https://pmc.ncbi.nlm.nih.gov/articles/PMC4255048/
Eligibility & terms of sale
This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.
FAQ
What is the purity and how is it verified?
Not less than 98% by HPLC; see the Certificate of Analysis for the lot-specific result.
What form does it ship in?
A lyophilized powder in a sealed vial.
Can you advise on dosing, reconstitution, or administration?
No. We provide batch documentation, storage, and handling information only; we do not provide dosing, reconstitution, administration, or therapeutic guidance.
Is lot-specific documentation available?
Yes - contact [email protected] with your lot number for the Certificate of Analysis.
Related reference materials
Sold by POWER BIOTECH LLC, Casper, WY 82609, United States · [email protected]. FOR LABORATORY RESEARCH USE ONLY. Not a drug, supplement, cosmetic, or food. Not for human or veterinary use, ingestion, injection, or any in-vivo administration. Not evaluated by the FDA.
