FOXO4-DRI (Proxofim)

FOXO4-DRI (Proxofim) is supplied as a laboratory research reference material for in-vitro and laboratory research use only. It is a 47-residue synthetic peptide constructed as a D-retro-inverso (DRI) analog: the primary sequence is reversed and each amino acid is substituted with its D-enantiomer, an arrangement that approximates the topological side-chain presentation of the parent L-peptide while conferring markedly greater resistance to proteolytic degradation in typical aqueous and biological buffer systems used at the bench.

The molecule is characterized by molecular formula C201H325N65O67, molecular weight approximately 4598 g/mol, and CAS 2103905-91-3. Its full amino-acid sequence is (D-Arg)9-LTLRKEPASEIAQSILEAYSQNGWANRRSAGGKRPPPRRRQRRKKRG, corresponding in three-letter notation to Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Ala-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly. The construct incorporates an N-terminal nona-D-arginine (D-Arg)9 cell-penetrating tag fused to a segment derived from the FOXO4-p53 interaction domain, giving the peptide a strongly cationic overall character driven by its multiple arginine and lysine residues, along with a single tryptophan that supports UV monitoring at 280 nm during analytical workflows.

FOXO4-DRI (Proxofim) is manufactured by solid-phase peptide synthesis from synthetic origin, purified by preparative reversed-phase HPLC, and supplied as a white to off-white lyophilized powder at a purity of not less than 98% by HPLC. Identity is routinely confirmed by mass spectrometry against the calculated monoisotopic and average masses, with residual solvent and counter-ion profiles reported per lot. Given its high arginine content and polycationic nature, formulators typically account for hygroscopicity, potential trifluoroacetate counter-ion content from purification, and solubility behavior in aqueous versus mildly acidic reconstitution media when designing analytical experiments.

Published scientific literature has examined FOXO4-DRI (Proxofim) in preclinical research contexts exploring FOXO4-p53 protein-protein interactions and cellular senescence biology; PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding this material and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. Identity and purity, including HPLC chromatograms and mass-spectrometric confirmation, are documented on the lot-specific Certificate of Analysis, available on request.

Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.

Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.

This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.