GLP-1S

GLP-1S (Catalog GLP-1S; CAS 910463-68-2; PubChem CID 56843331) is supplied as a laboratory research reference material intended exclusively for in-vitro and other non-clinical laboratory investigations. The material is produced by solid-phase synthetic assembly and isolated as a white to off-white lyophilized powder, with identity and purity confirmed against a lot-specific Certificate of Analysis available on request.

Structurally, GLP-1S is a 36-residue modified peptide amide with the primary sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG -amide (modified), expanded in three-letter notation as His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-Ala-Met-Ile-Asp-Glu. The molecule carries a lysine side-chain conjugate comprising a gamma-glutamate spacer, two AEEA (mini-PEG) linker units, and a C18 diacid fatty-acid moiety, a feature reflected in the canonical SMILES string and in the elemental composition C187H291N45O59. This lipidation architecture is a common design element in long-acting GLP-1 receptor agonist chemistry and is central to the characterization interest surrounding GLP-1S in analytical workflows.

Mass properties are well defined for reference comparison: the average molecular weight is 4113.58 g/mol and the monoisotopic mass is 4111.1154 Da, values suited to confirmation by high-resolution ESI-MS and to isotope-envelope deconvolution on Orbitrap or Q-TOF platforms. The InChIKey DLSWIYLPEUIQAV-CCUURXOWSA-N provides an unambiguous stereochemical fingerprint for database cross-referencing, and the residue count of 36 aligns with tryptic and Glu-C mapping strategies used in peptide identity workups. Purity is specified as not less than 98% by HPLC, typically evaluated by reversed-phase C18 gradient methods with UV detection at 214 nm and orthogonal confirmation by LC-MS.

For formulator and analytical chemists, the sequence includes handles of interest during characterization: a histidine at the N-terminus (UV and metal-affinity behavior), tryptophan and tyrosine residues supporting intrinsic fluorescence and A280 quantitation, a methionine subject to oxidation monitoring, and multiple acidic residues (Asp, Glu) that inform isoelectric behavior and ion-exchange retention. The lipid-PEG-glutamate side chain contributes pronounced hydrophobicity that should be considered when selecting reconstitution solvents, chromatographic mobile phases, and container-closure materials for reference standard handling.

Published scientific literature has examined GLP-1S in preclinical and in-vitro research contexts, and this listing is provided solely to support such analytical, identity, and characterization work. PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding GLP-1S and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion.

Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.

Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.

This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.