IGF-1LR3

IGF-1 LR3 (catalog IGF-1LR3) is supplied as a laboratory research reference material for in-vitro and laboratory research use only. This synthetic 83-residue polypeptide analog is structurally distinguished from native insulin-like growth factor by an N-terminal 13-residue extension (MFPAMPLSSLFVN) fused to a modified mature domain in which the position-3 glutamate is substituted with arginine, giving the "Long R3" designation encoded in the full sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA.

The material is characterized by molecular formula C400H625N111O115S9 and a monoisotopic-consistent average molecular weight of approximately 9117.6 g/mol, corresponding to CAS 946870-92-4. The primary structure contains six cysteine residues (positions 19, 31, 60, 61, 64 and 73 of the 83-mer) whose disulfide connectivity defines the folded tertiary architecture typical of the IGF scaffold, alongside three methionines and multiple basic (Arg/Lys) and aromatic (Phe/Tyr) residues that inform chromatographic retention, UV extinction at 280 nm, and tryptic mapping behavior. A three-letter rendering of the sequence (Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala) is provided to support unambiguous cross-referencing during peptide mapping, MS/MS assignment and analytical method development.

Physically, IGF-1 LR3 is presented as a white to off-white lyophilized powder of synthetic origin, with purity not less than 98% by reversed-phase HPLC and identity confirmed against the lot-specific Certificate of Analysis. The lyophilized form is intended to support reconstitution studies, reference-standard qualification, comparator characterization, orthogonal analytical assays (RP-HPLC, SEC, LC-MS, CD, peptide mapping) and receptor-binding or cell-based bench investigations conducted by qualified researchers.

Published scientific literature has examined IGF-1 LR3 in preclinical and in-vitro research contexts, and this listing is offered strictly to support such laboratory characterization work. PEPTIDE.Power makes no therapeutic, diagnostic or efficacy claims regarding this material and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic or food, and is not for human or veterinary use, injection or ingestion. Identity, purity, residual solvents and counter-ion content are documented on the lot-specific Certificate of Analysis, available on request.

Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.

Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.

This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.