PNC-27
$138.99
This material is supplied solely as a laboratory research article. Buyer is responsible for ensuring lawful purchase, handling, storage, and use. We do not provide administration or therapeutic guidance.
PNC-27 - Synthetic 32-Residue Chimeric Peptide, Research Reference Material
Analytical Identity
| Common name | PNC-27 |
|---|---|
| Amino-acid sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Sequence (3-letter) | Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly |
| Residues | 32 |
| CAS Number | 1159861-00-3 |
| PubChem CID | 16201774 |
| Molecular formula | C188H293N53O44S |
|---|---|
| Molecular weight | ~4031.8 g/mol |
| Monoisotopic mass | 4029.204 Da |
| Appearance | White to off-white lyophilized powder |
| Physical form | Lyophilized powder |
| Purity | Not less than 98% by HPLC (see lot-specific Certificate of Analysis) |
|---|---|
| Source | Synthetic |
| Catalog / SKU | PNC-27 |
PNC-27 is supplied as a laboratory research reference material: a synthetic 32-residue chimeric peptide provided as a white to off-white lyophilized powder. It is intended for in-vitro bench characterization and analytical workflows by qualified researchers, and is not formulated as a drug, supplement, cosmetic or food.
Analytical identifiers include molecular formula C188H293N53O44S, average molecular weight approximately 4031.8 g/mol, monoisotopic mass 4029.204 Da and expected [M+H]+ at 4030.211, with CAS number 1159861-00-3 and PubChem CID 16201774. The 1-letter sequence is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, where residues 1-15 correspond to the human p53 12-26 HDM-2-binding region and residues 16-32 are a 17-residue membrane-residency peptide leader. The sequence carries multiple basic residues (Lys, Arg) that drive a strongly cationic profile relevant to reversed-phase HPLC retention and electrospray charge-state distributions, while the Met and three Trp residues are oxidation-prone and should be monitored during LC-MS identity confirmation.
Purity is specified as not less than 98% by HPLC, and a lot-specific Certificate of Analysis documenting HPLC purity and mass-spectrometric identity is available on request.
Published in-vitro literature on this chimeric construct has examined its HDM-2 binding behavior and its interaction with lipid membrane systems, providing a chemistry-focused research context. PEPTIDE.Power makes no therapeutic, diagnostic or efficacy claims and provides no administration guidance; this material is not a drug, supplement, cosmetic or food, is not for human or veterinary use, injection or ingestion, and is offered for qualified researchers only.
Physical format
Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.
Certificate of Analysis
| Analyte | PNC-27 |
|---|---|
| CAS Number | 1159861-00-3 |
| Appearance | White to off-white lyophilized powder |
| Identity | Confirmed by HPLC and mass spectrometry |
| Expected [M+H]+ | m/z 4030.211 (calculated, monoisotopic) |
Lot-specific COA available — contact [email protected] with your lot number.
Storage & handling
Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.
Scientific references
The following are independent, peer-reviewed publications provided for reference. They describe third-party research and are not representations by POWER BIOTECH LLC regarding this product.
- Electronic structure and physicochemical properties characterization of the amino acids 12-26 of TP53: a theoretical study — https://pubmed.ncbi.nlm.nih.gov/17472350/
- Structural details on mdm2-p53 interaction — https://pubmed.ncbi.nlm.nih.gov/16159876/
- Membrane interaction and cellular internalization of penetratin peptides — https://pubmed.ncbi.nlm.nih.gov/15009197/
Eligibility & terms of sale
This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.
FAQ
What is the purity and how is it verified?
Not less than 98% by HPLC; see the Certificate of Analysis for the lot-specific result.
What form does it ship in?
A lyophilized powder in a sealed vial.
Can you advise on dosing, reconstitution, or administration?
No. We provide batch documentation, storage, and handling information only; we do not provide dosing, reconstitution, administration, or therapeutic guidance.
Is lot-specific documentation available?
Yes - contact [email protected] with your lot number for the Certificate of Analysis.
Related reference materials
Sold by POWER BIOTECH LLC, Casper, WY 82609, United States · [email protected]. FOR LABORATORY RESEARCH USE ONLY. Not a drug, supplement, cosmetic, or food. Not for human or veterinary use, ingestion, injection, or any in-vivo administration. Not evaluated by the FDA.
