LL-37

LL-37 is supplied as a laboratory research reference material for in-vitro and laboratory research use only. This synthetic 37-residue cathelicidin-derived peptide is characterized by the molecular formula C205H340N60O53, an average molecular weight of 4493.34 g/mol, a monoisotopic mass of 4490.5754 Da, and CAS number 154947-66-7. The primary structure corresponds to the amino-acid sequence [LL-37, 37 aa] (Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser), cross-referenced to PubChem CID 16198951 and InChIKey POIUWJQBRNEFGX-XAMSXPGMSA-N.

From a compositional standpoint, LL-37 is an amphipathic, cationic peptide rich in basic residues (six arginines and six lysines) balanced against acidic Asp/Glu positions, giving it a net positive charge at neutral pH and a hydrophobic face driven by leucine, isoleucine, valine, and phenylalanine clusters. A single proline at position 33 introduces a defined kink toward the C-terminus, and the peptide is well documented in the literature as adopting an alpha-helical conformation in the presence of anionic lipids, detergent micelles, or trifluoroethanol, a structural feature routinely probed by circular dichroism and NMR in analytical studies.

The material is provided as a white to off-white lyophilized powder from synthetic (solid-phase) origin, with purity not less than 98% by HPLC as documented on the lot-specific Certificate of Analysis. Identity is typically confirmed by reversed-phase HPLC retention and ESI-MS or MALDI-TOF mass matching the theoretical monoisotopic value, with residual TFA, water content, and peptide net content reported per lot. Formulators working with LL-37 as a reference standard commonly account for its cationic character, potential adsorption to glass and polypropylene surfaces at low concentrations, and sensitivity to strongly anionic buffer components when preparing analytical stock solutions.

Published scientific literature has examined LL-37 in preclinical research contexts as the mature C-terminal fragment of human cathelicidin hCAP-18; PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding this material and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. Identity and purity for each production lot of LL-37 (SKU LL-37) are documented on the lot-specific Certificate of Analysis, available on request.

Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.

Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.

This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.