TB-500 (Thymosin beta 4)

TB-500 (Thymosin Beta 4) is supplied as a laboratory research reference material intended strictly for in-vitro and laboratory research use only. This synthetic 43-residue polypeptide corresponds to the full-length human thymosin beta 4 sequence and is offered under catalog SKU TB-500 as a white to off-white lyophilized powder produced by solid-phase peptide synthesis.

The material is characterized by the molecular formula C212H350N56O78S, an average molecular weight of 4963.4 g/mol, and a monoisotopic mass of 4960.4863 Da, with CAS Registry Number 77591-33-4 and PubChem CID 16132341. Its primary structure follows the one-letter sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, corresponding in three-letter notation to Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser. The stereochemistry and connectivity are fully described by the canonical SMILES string provided in the technical data sheet and by the InChIKey UGPMCIBIHRSCBV-XNBOLLIBSA-N, which serves as a unique digital identifier for cross-referencing in cheminformatics workflows.

From a compositional standpoint, TB-500 (Thymosin Beta 4) is a highly acidic, hydrophilic peptide with a marked excess of glutamate, aspartate and lysine residues, a single methionine at position 6 (a common oxidation-monitoring site in stability studies), no cysteine (and therefore no disulfide bridges), and two internal proline residues at positions 4 and 27-29 that introduce local backbone rigidity. The absence of aromatic tryptophan and tyrosine means UV quantitation typically relies on peptide-bond absorbance in the 205-215 nm range rather than 280 nm, an important consideration for analytical formulators designing HPLC or spectrophotometric assays around this reference material.

Identity and purity of each production lot are established by orthogonal analytical techniques, including reversed-phase HPLC (purity not less than 98%), mass spectrometry for confirmation of intact molecular mass against the theoretical 4963.4 g/mol average and 4960.4863 Da monoisotopic values, and residual-solvent and water-content testing as appropriate. Lot-specific data are reported on the Certificate of Analysis, which is available on request and represents the authoritative record of identity, purity and physical characterization for the specific vial in hand.

Published scientific literature has examined TB-500 (Thymosin Beta 4) in preclinical research contexts, and the peptide is widely cited as a comparator and characterization standard in actin-binding and peptide-chemistry investigations. PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding this material and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion; it is sold solely as a chemical reference substance for qualified laboratory personnel operating under appropriate institutional oversight.

Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.

Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.

This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.