TB-500 (Thymosin beta 4)
$69.99 – $123.99Price range: $69.99 through $123.99
This material is supplied solely as a laboratory research article. Buyer is responsible for ensuring lawful purchase, handling, storage, and use. We do not provide administration or therapeutic guidance.
Quality Certificates
Independent third-party lab analysis (CoA) - from our own in-house brand.
📦Available in 2 stacks · save up to $105.95
Repair Matrix - Startsave $32.98View the stack →Repair Matrix - Advancedsave $105.95View the stack →TB-500 (Thymosin Beta 4) - Synthetic Actin-Binding Peptide, Research Reference Material
FOR LABORATORY RESEARCH USE ONLY. Not a drug, supplement, cosmetic, or food. Not for human or veterinary use, ingestion, injection, or any in-vivo administration. Not evaluated by the FDA.


Analytical Identity
| Common name | TB-500 (Thymosin Beta 4) |
|---|---|
| Amino-acid sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Sequence (3-letter) | Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser |
| Residues | 43 |
| CAS Number | 77591-33-4 |
| PubChem CID | 16132341 |
| InChIKey | UGPMCIBIHRSCBV-XNBOLLIBSA-N |
| SMILES | CCC(C)C(C(=O)NC(CCC(=O)O)C(=O)NC(CCCCN)C(=O)NC(CC1=CC=CC=C1)C(=O)NC(CC(=O)O)C(=O)NC(CCCCN)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(C(C)O)C(=O)NC(CCC(=O)O)C(=O)NC(C(C)O)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)O)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)N2CCCC2C(=O)NC(CC(C)C)C(=O)N3CCCC3C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCC(=O)O)C(=O)NC(C(C)O)C(=O)NC(C(C)CC)C(=O)NC(CCC(=O)O)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)O)C(=O)NC(CCCCN)C(=O)NC(CCC(=O)N)C(=O)NC(C)C(=O)NCC(=O)NC(CCC(=O)O)C(=O)NC(CO)C(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CCSC)NC(=O)C(CC(=O)O)NC(=O)C4CCCN4C(=O)C(CCCCN)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C |
| Molecular formula | C212H350N56O78S |
|---|---|
| Molecular weight | 4963.4 g/mol |
| Monoisotopic mass | 4960.4863 Da |
| Appearance | White to off-white lyophilized powder |
| Physical form | Lyophilized powder |
| Purity | Not less than 98% by HPLC (see lot-specific Certificate of Analysis) |
|---|---|
| Source | Synthetic |
| Catalog / SKU | TB-500 |
TB-500 (Thymosin Beta 4) is supplied as a laboratory research reference material intended strictly for in-vitro and laboratory research use only. This synthetic 43-residue polypeptide corresponds to the full-length human thymosin beta 4 sequence and is offered under catalog SKU TB-500 as a white to off-white lyophilized powder produced by solid-phase peptide synthesis.
The material is characterized by the molecular formula C212H350N56O78S, an average molecular weight of 4963.4 g/mol, and a monoisotopic mass of 4960.4863 Da, with CAS Registry Number 77591-33-4 and PubChem CID 16132341. Its primary structure follows the one-letter sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, corresponding in three-letter notation to Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser. The stereochemistry and connectivity are fully described by the canonical SMILES string provided in the technical data sheet and by the InChIKey UGPMCIBIHRSCBV-XNBOLLIBSA-N, which serves as a unique digital identifier for cross-referencing in cheminformatics workflows.
From a compositional standpoint, TB-500 (Thymosin Beta 4) is a highly acidic, hydrophilic peptide with a marked excess of glutamate, aspartate and lysine residues, a single methionine at position 6 (a common oxidation-monitoring site in stability studies), no cysteine (and therefore no disulfide bridges), and two internal proline residues at positions 4 and 27-29 that introduce local backbone rigidity. The absence of aromatic tryptophan and tyrosine means UV quantitation typically relies on peptide-bond absorbance in the 205-215 nm range rather than 280 nm, an important consideration for analytical formulators designing HPLC or spectrophotometric assays around this reference material.
Identity and purity of each production lot are established by orthogonal analytical techniques, including reversed-phase HPLC (purity not less than 98%), mass spectrometry for confirmation of intact molecular mass against the theoretical 4963.4 g/mol average and 4960.4863 Da monoisotopic values, and residual-solvent and water-content testing as appropriate. Lot-specific data are reported on the Certificate of Analysis, which is available on request and represents the authoritative record of identity, purity and physical characterization for the specific vial in hand.
Published scientific literature has examined TB-500 (Thymosin Beta 4) in preclinical research contexts, and the peptide is widely cited as a comparator and characterization standard in actin-binding and peptide-chemistry investigations. PEPTIDE.Power makes no therapeutic, diagnostic, or efficacy claims regarding this material and provides no administration or dosing guidance. This material is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion; it is sold solely as a chemical reference substance for qualified laboratory personnel operating under appropriate institutional oversight.
Physical format
Supplied as a lyophilized (freeze-dried) powder in a sealed vial. A research reference material - not a finished product and not a delivery device. Net contents per unit are shown in the product options.
Certificate of Analysis
| Issuing laboratory | Chromate |
|---|---|
| Analyte | TB-500 (Thymosin Beta 4) |
| CAS Number | 77591-33-4 |
| Lot / Batch | PPOWERJ851F6 |
| Appearance | White to off-white lyophilized powder |
| Purity (HPLC) | 99.9% |
| Identity | Confirmed by HPLC and mass spectrometry |
Lot-specific COA available — contact [email protected] with your lot number.
Storage & handling
Store the sealed lyophilized powder at -20 C, protected from light and moisture. After reconstitution for laboratory use, keep cold and use promptly. Handle per standard laboratory practice; a Safety Data Sheet (SDS) is available on request.
Scientific references
The following are independent, peer-reviewed publications provided for reference. They describe third-party research and are not representations by POWER BIOTECH LLC regarding this product.
- Thymosin beta4: a multi-functional regenerative peptide. Basic properties and clinical applications — https://pmc.ncbi.nlm.nih.gov/articles/PMC2716071/
- Thymosin beta4 and cardiac regeneration: are we missing a beat? — https://pubmed.ncbi.nlm.nih.gov/22643043/
- Thymosin beta4 induces angiogenesis through Notch signaling in endothelial cells — https://pmc.ncbi.nlm.nih.gov/articles/PMC3079293/
- Thymosin beta4 promotes cardiac cell survival and tissue repair — https://pubmed.ncbi.nlm.nih.gov/17988939/
- Thymosin beta4 and tissue regeneration: a review of its therapeutic potential in wound healing — https://pmc.ncbi.nlm.nih.gov/articles/PMC4812878/
- Thymosin beta4 in the eye: from bench to bedside — https://pubmed.ncbi.nlm.nih.gov/20536989/
Eligibility & terms of sale
This material is sold to qualified laboratory and research buyers for lawful research use only. It is not a drug, supplement, cosmetic, or food, and is not for human or veterinary use, injection, or ingestion. By purchasing, you confirm you are 21 or older and will use this material only for lawful laboratory research.
FAQ
What is the purity and how is it verified?
Not less than 98% by HPLC; see the Certificate of Analysis for the lot-specific result.
What form does it ship in?
A lyophilized powder in a sealed vial.
Can you advise on dosing, reconstitution, or administration?
No. We provide batch documentation, storage, and handling information only; we do not provide dosing, reconstitution, administration, or therapeutic guidance.
Is lot-specific documentation available?
Yes - contact [email protected] with your lot number for the Certificate of Analysis.
Related reference materials
Sold by POWER BIOTECH LLC, Casper, WY 82609, United States · [email protected]. FOR LABORATORY RESEARCH USE ONLY. Not a drug, supplement, cosmetic, or food. Not for human or veterinary use, ingestion, injection, or any in-vivo administration. Not evaluated by the FDA.
